Overview

  • Product name

    Recombinant Human GALNT7 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PRPDDPSPLSRMREDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVE VDLESIRRINKAKNEQEHHAGGDSQKDIMQRQYLTFKPQTFTYHDPVLRP GILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKQAIQASIKEFGFNMVA SDMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWSTLMRTVHS VIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREG LIQARSIGAQKAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRTICTVPL IDVINGNTYEIIPQGGGDEDGYARGAWDWSMLWKRVPLTPQEKRLRKTKT EPYRSPAMAGGLFAIEREFFFELGLYDPGLQIWGGENFEISYKIWQCGGK LLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTLKNYVRVVEVWWDEYKDY FYASRPESQALPYGDISELKKFREDHNCKSFKWFMEEIAYDITSHYPLPP KNVDWGEIRGFETAYCIDSMGKTNGGFVELGPCHRMGGNQLFRINEANQL MQYDQCLTKGADGSKVMITHCNLNEFKEWQYFKNLHRFTHIPSGKCLDRS EVLHQVFISNCDSSKTTQKWEMNNIHSVVDHHHHHH
    • Molecular weight

      73 kDa including tags
    • Amino acids

      30 to 657
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Lumenal domain

Specifications

Our Abpromise guarantee covers the use of ab185842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names

    • GalNAc T7
    • GalNAc-T7
    • GalNAcT7
    • GALNT 7
    • Galnt7
    • GALT7_HUMAN
    • N acetylgalactosaminyltransferase 7
    • N-acetylgalactosaminyltransferase 7
    • Polypeptide GalNAc transferase 7
    • Polypeptide N acetylgalactosaminyltransferase 7
    • pp GaNTase 7
    • pp-GaNTase 7
    • Protein UDP acetylgalactosaminyltransferase 7
    • Protein-UDP acetylgalactosaminyltransferase 7
    • UDP GalNAc:polypeptide N acetylgalactosaminyltransferase 7
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 7
    • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 7
    see all
  • Function

    Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified.
  • Tissue specificity

    Widely expressed. Expressed in uterus, retina, kidney, small intestine, omentum, stomach and CNS.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.
    Contains 1 ricin B-type lectin domain.
  • Domain

    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

References

ab185842 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up