Description

  • Product name

    Recombinant Human GALNTL2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLLRKRYRHRPCRLQFLLLLLMLGCVLMMVAMLHPPHHTLHQTVTAQASK HSPEARYRLDFGESQDWVLEAEDEGEEYSPLEGLPPFISLREDQLLVAVA LPQARRNQSQGRRGGSYRLIKQPRRQDKEAPKRDWGADEDGEVSEEEELT PFSLDPRGLQEALSARIPLQRALPEVRHPLCLQQHPQDSLPTASVILCFH DEAWSTLLRTVHSILDTVPRAFLKEIILVDDLSQQGQLKSALSEYVARLE GVKLLRSNKRLGAIRARMLGATRATGDVLVFMDAHCECHPGWLEPLLSRI AGDRSRVVSPVIDVIDWKTFQYYPSKDLQRGVLDWKLDFHWEPLPEHVRK ALQSPISPIRSPVVPGEVVAMDRHYFQNTGAYDSLMSLRGGENLELSFKA WLCGGSVEILPCSRVGHIYQNQDSHSPLDQETTLRNRVRIAETWLGSFKE TFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSE PRPSFSGKLHNTGLGLCADCQAEGDILGCPMVLAPCSDSRQQQYLQHTSR KEIHFGSPQHLCFAVRQEQVILQNCTEEGLAIHQQHWDFQENGMIVHILS GKCMEAVVQENNKDLYLRPCDGKARQQWRFDQINAVDER
    • Amino acids

      1 to 639
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EC 2.4.1.41
    • GalNAc T like protein 2
    • GALNT13
    • GALNT15
    • GALNT7
    • GALNTL2
    • GaNTase like protein 2
    • mpp GalNAc T15
    • PIH5
    • Polypeptide GalNAc transferase like protein 2
    • polypeptide N acetylgalactosaminyltransferase 13
    • Polypeptide N acetylgalactosaminyltransferase like protein 2
    • pp GaNTase like protein 2
    • pregnancy induced hypertension syndrome related protein 5
    • Protein UDP acetylgalactosaminyltransferase like protein 2
    • UDP GalNAc transferase T15
    • UDP GalNAc:polypeptide N acetylgalactosaminyltransferase like protein 2
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 7
    • UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase like 2
    see all
  • Relevance

    GALNTL2 catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Although it displays a much weaker activity toward all substrates tested compared to GALNT2, it is able to transfer up to seven GalNAc residues to the Muc5AC peptide, suggesting that it can fill vicinal Thr/Ser residues in cooperation with other GALNT proteins. Prefers Muc1a as substrate.
  • Cellular localization

    Golgi apparatus membrane; Single-pass type II membrane protein

Images

  • ab165133 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165133 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up