Recombinant Human Gamma Hydroxybutyrate CoA Transferase protein (ab166874)

Overview

  • Product name
    Recombinant Human Gamma Hydroxybutyrate CoA Transferase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDWKKIYEDRTCTADEAVKSIKSGDRVLFAHCVAEPPVLVEAMVANAAAY KNVTVSHMVTLGKGEYSKPEYKENFTFEGWFTSPSTRGSIAEGHGQFVPV FFHEVPSLIRKDIFHVDVFMVMVSPPDHNGFCCVGVSSDYTMQAIKSAKI VLAEVNDQVPVVYGDTFVHVSEIDKFVETSHPLPEIGLPKIGEVEAAIGK HCASLIEDGSTLQLGIGAIPDAVLSQLKDKKHLGIHSEMISDGVVDLYEA GVIDCSQKSIDKGKMAITFLMGTKRLYDFAANNPKVELKPVDYINHPSVV AQCSKMVCINACLQVDFMGQIVSDSIGTKQFSGVGGQVDFVRGASMSIDG KGKAIIAMPSVAKKKDGSMISKIVPFIDHGAAVTTSRNDADYVVTEYGIA EMKGKSLQDRARALINIAHPDFKDELKAEFEKRFNAAF
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 438
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: 0.32% Tris HCl, 50% Glycerol

General Info

  • Alternative names
    • Acetate CoA-transferase YdiF
    • ECs2401
    • Short-chain acyl-CoA:acetate CoA-transferase
    • ydiF
    • YDIF_ECO57
    see all
  • Function
    CoA transferase having broad substrate specificity for short-chain acyl-CoA thioesters with the activity decreasing when the length of the carboxylic acid chain exceeds four carbons. Exhibits high activity with acetoacetyl-CoA, propionyl-CoA, crotonoyl-CoA or butyryl-CoA as donors, with acetate as an acceptor. When acetyl-CoA is used as the donor, propionate, acetoacetate, butyrate, isobutyrate, and 4-hydroxybutyrate can be utilized as acceptors but not isovalerate. May play a role in short-chain fatty acid metabolism in E.coli.
  • Sequence similarities
    Belongs to the 3-oxoacid CoA-transferase family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab166874.

References

ab166874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up