Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online

Recombinant Human gamma Tubulin protein (denatured) (ab115710)

Submit a review Q&A (2)References (1)
SDS-PAGE - Recombinant Human gamma Tubulin protein (denatured) (ab115710)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 85% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: SDS-PAGE

    Description

    • Product name

      Recombinant Human gamma Tubulin protein (denatured)

    • Purity

      > 85 % SDS-PAGE.

    • Expression system

      Escherichia coli

    • Accession

      P23258

    • Protein length

      Full length protein

    • Animal free

      No

    • Nature

      Recombinant

      • Species

        Human

      • Sequence

        MGSSHHHHHHSSGLVPRGSHMPREIITLQLGQCGNQIGFEFWKQLCAEHG ISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNS PYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSD SLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQ LVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDP TQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMAN HTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQ LIDEYHAATRPDYISWGTQEQ

      • Predicted molecular weight

        53 kDa including tags

      • Amino acids

        1 to 451

      • Tags

        His tag N-Terminus

    • Description

      Recombinant Human gamma Tubulin protein

    Specifications

    Our Abpromise guarantee covers the use of ab115710 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

      pH: 8.00
      Constituents: 6% Urea, 0.32% Tris HCl, 5% Glycerol (glycerin, glycerine)

    General Info

    • Alternative names

      • Gamma 1 tubulin
      • Gamma 2 tubulin
      • Gamma Tubulin 1
      • Gamma Tubulin 2
      • Gamma tubulin complex component 1
      • Gamma-2-tubulin
      • GCP 1
      • GCP-1
      • GCP1
      • MGC131994
      • TBG2_HUMAN
      • TUBG
      • TUBG1
      • TUBG2
      • TUBGCP1
      • Tubulin gamma 1 chain
      • Tubulin gamma 2 chain
      • Tubulin gamma complex-associated protein 1
      • Tubulin gamma-2 chain
      • tubulin, gamma 1
      • tubulin, gamma 2
      • tubulin, gamma polypeptide
      • Xgam
      see all

    • Function

      Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome. Pericentriolar matrix component that regulates alpha/beta tubulin minus-end nucleation, centrosome duplication and spindle formation.

    • Sequence similarities

      Belongs to the tubulin family.

    • Post-translational
      modifications

      Phosphorylation at Ser-131 by BRSK1 regulates centrosome duplication, possibly by mediating relocation of gamma-tubulin and its associated proteins from the cytoplasm to the centrosome.

    • Cellular localization

      Cytoplasm > cytoskeleton > centrosome.
    • Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human gamma Tubulin protein (denatured) (ab115710)
      SDS-PAGE - Recombinant Human gamma Tubulin protein (denatured) (ab115710)
      15% SDS-PAGE showing ab115710 at approximately 53.3kDa (3µg).

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (1)

    Publishing research using ab115710? Please let us know so that we can cite the reference in this datasheet.

    ab115710 has been referenced in 1 publication.

    • Larsson VJ  et al. Mitotic spindle assembly and ?-tubulin localisation depend on the integral nuclear membrane protein Samp1. J Cell Sci 131:N/A (2018). PubMed: 29514856

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Question

    I Have recently purchase the above product. I have noticed on a gel there are 3 contaminates above 100KDa. Do you know what these are? They seem to be reacting with a anti gamma tubulin antibody (from another supplier). I am thinking they are aggregates but wondered if you have investigated this.

    Thanks

    Read More
    Answer

    Thank you for your enquiry and your interest in our products.

    The Lab has retested this protein and it is very likely that the higher band at 100 kDa represents the multimer forms. I have attached the image to this response and hope that you can open this file. As you can see, without DTT in the SDS sample buffer, the protein didn’t move properly through the gel matrix. With the DTT, longer boiling time yielded better results i.e. less of the multimer bands and a stronger 53 kDa band.

    I hope this helps and if I can assist further, please do not hesitate to contact me.

    Read More

    Question

    I Have recently purchase the above product. I have noticed on a gel there are 3 contaminates above 100KDa. Do you know what these are? They seem to be reacting with a anti gamma tubulin antibody (from another supplier). I am thinking they are aggregates but wondered if you have investigated this.



    Thanks

    Read More
    Answer

    I am sorry to hear that you have been experiencing problems using this product in the application that you wish.

    Please could you provide some further details of the protocol used and complete the following form (attached as a word document). It would be much appreciated if you could provide the batch number and attach an image to the response.

    Thank you for your understanding and co-operation in this matter. I look forward to hearing from you soon and resolving this issue as soon as possible.

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com