For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-gamma-tubulin-protein-denatured-ab115710.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Cytoskeleton / ECM Cytoskeleton Microtubules Tubulin
Share by email

Recombinant Human gamma Tubulin protein (denatured) (ab115710)

  • Datasheet
Submit a review Q&A (2)References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human gamma Tubulin protein (denatured) (ab115710)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 85% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: SDS-PAGE

    Description

    • Product name

      Recombinant Human gamma Tubulin protein (denatured)
    • Purity

      > 85 % SDS-PAGE.

    • Expression system

      Escherichia coli
    • Accession

      P23258
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MGSSHHHHHHSSGLVPRGSHMPREIITLQLGQCGNQIGFEFWKQLCAEHG ISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNS PYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSD SLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSD VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQ LVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDP TQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMAN HTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQ LIDEYHAATRPDYISWGTQEQ
      • Predicted molecular weight

        53 kDa including tags
      • Amino acids

        1 to 451
      • Tags

        His tag N-Terminus
    • Description

      Recombinant Human gamma Tubulin protein

    Associated products

    • Related Products

      • Anti-gamma Tubulin antibody (ab11317)
      • Anti-gamma Tubulin antibody - Centrosome Marker (ab16504)
      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-gamma Tubulin antibody [TU-30] (ab27074)
      • Anti-6X His tag® antibody [4D11] (ab5000)

    Specifications

    Our Abpromise guarantee covers the use of ab115710 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

      pH: 8.00
      Constituents: 6% Urea, 0.32% Tris HCl, 5% Glycerol (glycerin, glycerine)

    General Info

    • Alternative names

      • Gamma 1 tubulin
      • Gamma 2 tubulin
      • Gamma Tubulin 1
      • Gamma Tubulin 2
      • Gamma tubulin complex component 1
      • Gamma-2-tubulin
      • GCP 1
      • GCP-1
      • GCP1
      • MGC131994
      • TBG2_HUMAN
      • TUBG
      • TUBG1
      • TUBG2
      • TUBGCP1
      • Tubulin gamma 1 chain
      • Tubulin gamma 2 chain
      • Tubulin gamma complex-associated protein 1
      • Tubulin gamma-2 chain
      • tubulin, gamma 1
      • tubulin, gamma 2
      • tubulin, gamma polypeptide
      • Xgam
      see all
    • Function

      Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome. Pericentriolar matrix component that regulates alpha/beta tubulin minus-end nucleation, centrosome duplication and spindle formation.
    • Sequence similarities

      Belongs to the tubulin family.
    • Post-translational
      modifications

      Phosphorylation at Ser-131 by BRSK1 regulates centrosome duplication, possibly by mediating relocation of gamma-tubulin and its associated proteins from the cytoplasm to the centrosome.
    • Cellular localization

      Cytoplasm > cytoskeleton > centrosome.
    • Target information above from: UniProt accession Q9NRH3 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human gamma Tubulin protein (denatured) (ab115710)
      SDS-PAGE - Recombinant Human gamma Tubulin protein (denatured) (ab115710)
      15% SDS-PAGE showing ab115710 at approximately 53.3kDa (3µg).

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab115710? Please let us know so that we can cite the reference in this datasheet.

    ab115710 has been referenced in 1 publication.

    • Larsson VJ  et al. Mitotic spindle assembly and ?-tubulin localisation depend on the integral nuclear membrane protein Samp1. J Cell Sci 131:N/A (2018). PubMed: 29514856

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Question

    I Have recently purchase the above product. I have noticed on a gel there are 3 contaminates above 100KDa. Do you know what these are? They seem to be reacting with a anti gamma tubulin antibody (from another supplier). I am thinking they are aggregates but wondered if you have investigated this.

    Thanks

    Read More

    Abcam community

    Verified customer

    Asked on Feb 09 2012

    Answer

    Thank you for your enquiry and your interest in our products.

    The Lab has retested this protein and it is very likely that the higher band at 100 kDa represents the multimer forms. I have attached the image to this response and hope that you can open this file. As you can see, without DTT in the SDS sample buffer, the protein didn’t move properly through the gel matrix. With the DTT, longer boiling time yielded better results i.e. less of the multimer bands and a stronger 53 kDa band.

    I hope this helps and if I can assist further, please do not hesitate to contact me.

    Read More

    Abcam Scientific Support

    Answered on Feb 09 2012

    Question

    I Have recently purchase the above product. I have noticed on a gel there are 3 contaminates above 100KDa. Do you know what these are? They seem to be reacting with a anti gamma tubulin antibody (from another supplier). I am thinking they are aggregates but wondered if you have investigated this.



    Thanks

    Read More

    Abcam community

    Verified customer

    Asked on Feb 02 2012

    Answer

    I am sorry to hear that you have been experiencing problems using this product in the application that you wish.

    Please could you provide some further details of the protocol used and complete the following form (attached as a word document). It would be much appreciated if you could provide the batch number and attach an image to the response.

    Thank you for your understanding and co-operation in this matter. I look forward to hearing from you soon and resolving this issue as soon as possible.

    Read More

    Abcam Scientific Support

    Answered on Feb 02 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.