Description

  • Product name

    Recombinant Human GANP protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTA RKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA
    • Amino acids

      1 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 80 kDa MCM3 associated protein
    • 80 kDa MCM3-associated protein
    • FLJ44336
    • FLJ45306
    • Germinal center associated nuclear protein
    • KIAA0572
    • MAP80
    • MCM3 import protein
    • MCM3 minichromosome maintenance deficient 3 associated protein
    • MCM3A
    • MCM3A_HUMAN
    • Mcm3ap
    • Minichromosome maintenance complex component 3 associated protein
    • Minichromosome maintenance deficient 3 associated protein
    • Minichromosome maintenance protein 3 associated protein
    • Protein GANP
    • SAC3
    see all
  • Function

    May be involved in the nuclear localization pathway of MCM3.
  • Sequence similarities

    Belongs to the SAC3 family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab160246 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160246 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up