Description

  • Product name

    Recombinant Human GAPDH protein (His tag)
    See all GAPDH proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDS THGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGV FTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNAS CTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRG ALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEK PAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGI ALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      2 to 335
    • Tags

      His tag N-Terminus
    • Additional sequence information

      AAH01601.

Specifications

Our Abpromise guarantee covers the use of ab223103 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.87% Sodium chloride, 5% Trehalose, 0.61% Tris

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 38 kDa BFA-dependent ADP-ribosylation substrate
    • aging associated gene 9 protein
    • Aging-associated gene 9 protein
    • BARS-38
    • cb609
    • EC 1.2.1.12
    • Epididymis secretory sperm binding protein Li 162eP
    • G3P_HUMAN
    • G3PD
    • G3PDH
    • GAPD
    • GAPDH
    • Glyceraldehyde 3 phosphate dehydrogenase
    • glyceraldehyde 3-PDH
    • Glyceraldehyde-3-phosphate dehydrogenase
    • HEL-S-162eP
    • KNC-NDS6
    • MGC102544
    • MGC102546
    • MGC103190
    • MGC103191
    • MGC105239
    • MGC127711
    • MGC88685
    • OCAS, p38 component
    • OCT1 coactivator in S phase, 38-KD component
    • peptidyl cysteine S nitrosylase GAPDH
    • Peptidyl-cysteine S-nitrosylase GAPDH
    • wu:fb33a10
    see all
  • Function

    Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC (By similarity). Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate.
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 1/5.
  • Sequence similarities

    Belongs to the glyceraldehyde-3-phosphate dehydrogenase family.
  • Post-translational
    modifications

    S-nitrosylation of Cys-152 leads to interaction with SIAH1, followed by translocation to the nucleus.
    ISGylated.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus. Cytoplasm > perinuclear region. Membrane. Translocates to the nucleus following S-nitrosylation and interaction with SIAH1, which contains a nuclear localization signal (By similarity). Postnuclear and Perinuclear regions.
  • Information by UniProt

Images

  • ab223103 analyzed by DTT-reduced SDS-PAGE and stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 37 kDa in SDS-PAGE.

References

ab223103 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223103.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up