Description

  • Product name

    Recombinant Human GARNL1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EPEPLHSPDSERSSKLQPVTEVKTQMQHGLISIAARTVITHLVNHLGHYP MSGGPAMLTSQVCENHDNHYSESTELSPELFESPNIQFFVLNNTTLVSCI QIRSEENM
    • Amino acids

      1472 to 1579
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp566D133
    • DKFZp667F074
    • GAP related interacting partner to E12
    • GAP related interacting protein to E12
    • GARN L1
    • GARNL 1
    • GRIPE
    • GTPase activating RANGAP domain like 1
    • GTPase activating Rap/RanGAP domain like 1
    • KIAA0884
    • p240
    • Ral GTPase activating protein catalytic alpha subunit 1
    • Ral GTPase activating protein subunit alpha 1
    • Ral GTPase activating protein, alpha subunit 1 (catalytic)
    • RalGAPalpha1
    • Tuberin like protein 1
    • TULIP 1
    • TULIP1
    see all
  • Relevance

    GTPase activating Rap/RanGAP domain-like 1 (GARNL1) is an interacting partner of the transcription factor TCF3/isoform E12, mainly in the developing embryonic forebrain. It may be an important transcriptional regulator of downstream target genes under the control of TCF3/E12, by disrupting HLH dimer formation of TCF3/E12 with other proteins and may be involved in neuronal differentiation.
  • Cellular localization

    Cytoplasmic and Nuclear. Translocated to the nucleus when associated with TCF3/E12

Images

  • ab166021 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up