Description

  • Product name

    Recombinant Human GAS 6 protein
    See all GAS 6 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQRRAF QVFEEAKQGHLERECVEELCSREEAREVFENDPETDYFYPRYLDCINKYG SPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGG RLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFELSSDGRTCQDIDE CADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVDECLQGRCEQV CVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKSLYLGRM FSGTPVIRLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLAL RAGRLELQLRYNGVGRVTSSGPVINHGMWQTISVEELARNLVIKVNRDAV MKIAVAGDLFQPERGLYHLNLTVGGIPFHEKDLVQPINPRLDGCMRSWNW LNGEDTTIQETVKVNTRMQCFSVTERGSFYPGSGFAFYSLDYMRTPLDVG TESTWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKK QLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVS AAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNR RLLDLDEAAYKHSDITAHSCPPVEPAAA
    • Predicted molecular weight

      101 kDa including tags
    • Amino acids

      1 to 678
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AXL receptor tyrosine kinase ligand
    • AXL stimulatory factor
    • AXLLG
    • AXS F
    • AXSF
    • DKFZp666G247
    • FLJ34709
    • Gas 6
    • GAS-6
    • Gas6
    • GAS6_HUMAN
    • Growth arrest specific 6
    • Growth arrest-specific protein 6
    • Growth-arrest-specific protein 6
    • Growth-arrest-specific protein 6 precursor
    see all
  • Function

    Ligand for tyrosine-protein kinase receptors AXL, TYRO3 and MER whose signaling is implicated in cell growth and survival, cell adhesion and cell migration. GAS6/AXL signaling plays a role in various processes such as endothelial cell survival during acidification by preventing apoptosis, optimal cytokine signaling during human natural killer cell development, hepatic regeneration, gonadotropin-releasing hormone neuron survival and migration, platelet activation, or regulation of thrombotic responses.
  • Tissue specificity

    Plasma. Isoform 1 and isoform 2 are widely expressed. Isoform 1 is the predominant form in spleen.
  • Sequence similarities

    Contains 4 EGF-like domains.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
    Contains 2 laminin G-like domains.
  • Post-translational
    modifications

    Isoform 1 is proteolytically processed after secretion to yield a N-terminal 36 kDa protein and a C-terminal 50 kDa protein including the laminin G-like domains which activates AXL.
    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131810 stained with Coomassie Blue.

References

ab131810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us.

To our knowledge, this tagged recombinant Gas6 protein has not been tested for activity. It is useful for SDS-PAGE, western blotting, and ELISA.

Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up