Recombinant Human Gastrin protein (ab131754)

Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQ GPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDE N
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1 to 101

Specifications

Our Abpromise guarantee covers the use of ab131754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Component II
    • G14
    • G17
    • G34
    • G52
    • G6
    • GAS
    • Gast
    • GAST_HUMAN
    • Gastrin
    • Gastrin component I
    • Gastrin component II
    • Gastrin component III
    • Gastrin precursor
    • Gastrin-14
    • Gastrin-17
    • Gastrin-34
    • Gastrin-52
    • Gastrin-6
    • Gastrin-71
    see all
  • Function

    Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
  • Sequence similarities

    Belongs to the gastrin/cholecystokinin family.
  • Post-translational
    modifications

    Two different processing pathways probably exist in antral G-cells. In the dominant pathway progastrin is cleaved at three sites resulting in two major bioactive gastrins, gastrin-34 and gastrin-17. In the putative alternative pathway, progastrin may be processed only at the most C-terminal dibasic site resulting in the synthesis of gastrin-71.
    Sulfation enhances proteolytic processing, and blocks peptide degradation. Levels of sulfation differ between proteolytically-cleaved gastrins. Thus, gastrin-6 is almost 73% sulfated, whereas the larger gastrins are less than 50% sulfated. Sulfation levels are also tissue-specific.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131754, stained with Coomassie Blue.

References

ab131754 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

It is correct the protein is GST tagged at N-terminal end.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up