Description

  • Product name

    Recombinant Human GATA1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab204189 was expressed in E. coli as inclusion bodies, refolded using a temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGEFPGLGSLGTSEPLPQFVDPALVS STPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVF QVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLD GKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSP TGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLC NACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASG DPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSSLGGTG AAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGP VSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      2 to 413
    • Additional sequence information

      Expressed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal. Accession Number: NP_002040

Specifications

Our Abpromise guarantee covers the use of ab204189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituent: 0.32% Tris HCl

    Contains NaCl, EDTA, KCl, arginine, DTT and glycerol.

General Info

  • Alternative names

    • Anemia, X-linked, without thrombocytopenia, included
    • ERYF 1
    • Eryf1
    • Erythroid transcription factor
    • Erythrold transcription factor 1
    • GATA 1
    • GATA binding factor 1
    • GATA binding protein 1
    • GATA binding protein 1 (globin transcription factor 1)
    • GATA-1
    • GATA-binding factor 1
    • GATA1
    • GATA1_HUMAN
    • GF 1
    • GF-1
    • GF1
    • Globin transcription factor 1
    • NF E1
    • NF E1 DNA binding protein
    • NF-E1 DNA-binding protein
    • NFE 1
    • NFE1
    • Nuclear factor erythroid 1
    • Transcription factor GATA1
    • XLANP
    • XLTDA
    • XLTT
    see all
  • Function

    Transcriptional activator which probably serves as a general switch factor for erythroid development. It binds to DNA sites with the consensus sequence [AT]GATA[AG] within regulatory regions of globin genes and of other genes expressed in erythroid cells.
  • Tissue specificity

    Erythrocytes.
  • Involvement in disease

    Defects in GATA1 are the cause of X-linked dyserythropoietic anemia and thrombocytopenia (XDAT) [MIM:300367]. XDAT is a disorder characterized by erythrocytes with abnormal size and shape, and paucity of platelets in peripheral blood. The bone marrow contains abundant and abnormally small megakaryocytes.
    Defects in GATA1 are the cause of X-linked thrombocytopenia with beta-thalassemia (XLTT) [MIM:314050]; also knwon as thrombocytopenia, platelet dysfunction, hemolysis, and imbalanced globin synthesis. XLTT consists of an unusual form of thrombocytopenia with beta-thalassemia. Patients have splenomegaly and petechiae, moderate thrombocytopenia, prolonged bleeding time due to platelet dysfunction, reticulocytosis and unbalanced hemoglobin chain synthesis resembling that of beta-thalassemia minor.
    Defects in GATA1 are the cause of anemia without thrombocytopenia X-linked (XLAWT) [MIM:300835]. XLAWT is a form of anemia characterized by abnormal morphology of erythrocytes and granulocytes in peripheral blood, bone marrow dysplasia with hypocellularity of erythroid and granulocytic lineages, and normal or increased number of megakaryocytes. Neutropenia of a variable degree is present in affected individuals.
  • Sequence similarities

    Contains 2 GATA-type zinc fingers.
  • Domain

    The two fingers are functionally distinct and cooperate to achieve specific, stable DNA binding. The first finger is necessary only for full specificity and stability of binding, whereas the second one is required for binding.
  • Post-translational
    modifications

    Highly phosphorylated on serine residues. Phosphorylation on Ser-310 is enhanced on erythroid differentiation. Phosphorylation on Ser-142 promotes sumoylation on Lys-137.
    Sumoylation on Lys-137 is enhanced by phosphorylation on Ser-142 and by interaction with PIAS4. Sumoylation by SUMO1 has no effect on transcriptional activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab204189 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204189.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up