Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      (29 amino acid tag)EVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDV FFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPW LDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGG SGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSS AGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIP TYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVN CGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGT CCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRN RKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFS HSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMGLEESGGGGSPGRRRRRR RRRRR
    • Molecular weight
      50 kDa
    • Amino acids
      2 to 480

Specifications

Our Abpromise guarantee covers the use of ab134866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: Potassium chloride, 0.05% DTT, 0.32% Tris HCl, 0.02% EDTA, Glycerol, Sodium chloride, 3.4% DL-Arginine

General Info

  • Alternative names
    • DCML
    • Endothelial transcription factor GATA 2
    • Endothelial transcription factor GATA-2
    • Endothelial transcription factor GATA2
    • FLJ45948
    • GATA 2
    • GATA binding protein 2
    • GATA-binding protein 2
    • Gata2
    • GATA2_HUMAN
    • IMD21
    • MGC2306
    • MONOMAC
    • NFE 1B
    • NFE1B
    • OTTHUMP00000216240
    see all
  • Function
    Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'.
  • Tissue specificity
    Endothelial cells.
  • Sequence similarities
    Contains 2 GATA-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab134866 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up