Overview

  • Product name

    Recombinant Human GATA3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGEVTADQPRWVSHHHPAVLNGQHPD THHPGLSHSYMDAA QYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQ RYPPTHHGSQVCRPPLLHGSLPWLDGGKAL GSHHTASPWNLSPFSKTS IHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSL ST PGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPI TTYPPYVPEYSS GLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCG ATSTPLWRRDGTGHYLCNACGLYHKMNG QNRPLIKPKRRLSAARRAGT SCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE GIQT RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS HMLTTPTPMH PPSSLSFGPHHPSSMVTAMG
    • Molecular weight

      51 kDa including tags
    • Amino acids

      2 to 443
    • Additional sequence information

      Full length protein without initiator methionine and a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal

Specifications

Our Abpromise guarantee covers the use of ab204202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    > 90 % SDS-PAGE.
    refolded and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • GATA 3
    • GATA binding factor 3
    • GATA binding protein 3
    • GATA-binding factor 3
    • Gata3
    • GATA3_HUMAN
    • HDR
    • HDRS
    • MGC2346
    • MGC5199
    • MGC5445
    • Trans acting T cell specific transcription factor GATA 3
    • Trans-acting T-cell-specific transcription factor GATA-3
    see all
  • Function

    Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'.
  • Tissue specificity

    T-cells and endothelial cells.
  • Involvement in disease

    Defects in GATA3 are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia (HDR) [MIM:146255]; also known as Barakat syndrome.
  • Sequence similarities

    Contains 2 GATA-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab204202 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204202.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up