Overview

  • Product name

    Recombinant Human GBA3 protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAFPAGFGWAAATAAYQVEGGWDADGK GPCVWDTFTHQGGERVFKNQTGDVACGSYTLWEEDLKCIKQLGLTHYRFS LSWSRLLPDGTTGFINQKGIDYYNKIIDDLLKNGVTPIVTLYHFDLPQTL EDQGGWLSEAIIESFDKYAQFCFSTFGDRVKQWITINEANVLSVMSYDLG MFPPGIPHFGTGGYQAAHNLIKAHARSWHSYDSLFRKKQKGMVSLSLFAV WLEPADPNSVSDQEAAKRAITFHLDLFAKPIFIDGDYPEVVKSQIASMSQ KQGYPSSRLPEFTEEEKKMIKGTADFFAVQYYTTRLIKYQENKKGELGIL QDAEIEFFPDPSWKNVDWIYVVPWGVCKLLKYIKDTYNNPVIYITENGFP QSDPAPLDDTQRWEYFRQTFQELFKAIQLDKVNLQVYCAWSLLDNFEWNQ GYSSRFGLFHVDFEDPARPRVPYTSAKEYAKIIRNNGLEAHL
    • Molecular weight

      56 kDa including tags
    • Amino acids

      1 to 469
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_066024.

Specifications

Our Abpromise guarantee covers the use of ab187481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.
    ab187481 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.02% DTT, 20% Glycerol, 79% PBS

General Info

  • Alternative names

    • CBG
    • CBGL1
    • Cytosolic beta glucosidase
    • Cytosolic beta glucosidase like protein 1
    • Cytosolic beta-glucosidase
    • Cytosolic beta-glucosidase-like protein 1
    • GBA3
    • GBA3_HUMAN
    • GLUC
    • Glucosidase beta acid 3
    • Klotho related protein
    • KLRP
    see all
  • Function

    Glycosidase probably involved in the intestinal absorption and metabolism of dietary flavonoid glycosides. Able to hydrolyze a broad variety of glycosides including phytoestrogens, flavonols, flavones, flavanones and cyanogens. Possesses beta-glycosylceramidase activity and may be involved in a nonlysosomal catabolic pathway of glycosylceramide.
  • Tissue specificity

    Present in small intestine (at protein level). Expressed in liver, small intestine, colon, spleen and kidney. Down-regulated in renal cell carcinomas and hepatocellular carcinomas.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 1 family. Klotho subfamily.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3μg ab187481.

References

ab187481 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up