Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWRE ESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS
    • Amino acids
      248 to 347
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-N-acetylgalactosaminyltransferase 1
    • A3GALNT
    • EC=2.4.1.-
    • Forssman glycolipid synthase-like protein
    • Forssman glycolipid synthetase (FS)
    • Forssman synthetase
    • FS
    • GBGT1
    • GBGT1_HUMAN
    • Globoside alpha-1
    • globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
    • glycolipid synthase-like protein
    • RP11-326L24.6
    • UNQ2513
    • UNQ2513/PRO6002
    see all
  • Function
    Catalyzes the formation of some glycolipid via the addition of N-acetylgalactosamine (GalNAc) in alpha-1,3-linkage to some substrate. Glycolipids probably serve for adherence of some pathogens.
  • Tissue specificity
    Widely expressed. Expressed at higher level in placenta, ovary and peripheral blood leukocyte, whereas it is weakly expressed in liver, thymus, and testis.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 6 family.
  • Domain
    The conserved DXD motif is involved in cofactor binding. The manganese ion interacts with the beta-phosphate group of UDP and may also have a role in catalysis.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab161971 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up