Overview

  • Product name
    Recombinant Human GC-C protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAG LNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPS CTYSTFQMYL
    • Amino acids
      24 to 133
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as GUCY2C. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GC-C
    • Guanylyl cyclase C
    • GUC2C
    • GUC2C_HUMAN
    • GUCY2C
    • Heat stable enterotoxin receptor
    • Heat-stable enterotoxin receptor
    • hSTAR
    • Intestinal guanylate cyclase
    • STA receptor
    see all
  • Function
    Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptide guanylin.
  • Sequence similarities
    Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
    Contains 1 guanylate cyclase domain.
    Contains 1 protein kinase domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158612 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up