Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      VLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIA QAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILD TNLKEWELHS
    • Amino acids

      311 to 420
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PGCG.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CYGF
    • GC F
    • GC-F
    • guanylate cyclase 2D-like, membrane (retina-specific)
    • Guanylate cyclase 2F
    • Guanylate cyclase 2F, retinal
    • Guanylate cyclase F
    • GUC2DL
    • GUC2F
    • GUC2F_HUMAN
    • Gucy2f
    • PGCG
    • RETGC-2
    • RETGC2
    • retinal
    • Retinal guanylyl cyclase 2
    • Rod outer segment membrane guanylate cyclase 2
    • ROS-GC2
    see all
  • Function

    Probably plays a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction.
  • Tissue specificity

    Retina. Localized exclusively in the outer nuclear layer and inner segments of the rod and cone photoreceptor cells.
  • Sequence similarities

    Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
    Contains 1 guanylate cyclase domain.
    Contains 1 protein kinase domain.
  • Domain

    The protein kinase domain is predicted to be catalytically inactive.
  • Post-translational
    modifications

    There are 9 conserved cysteine residues in sensory guanylate cyclases, 6 in the extracellular domain, which may be involved in intra- or interchain disulfide bonds.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab158613 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up