Recombinant Human GC1q R protein (ab172818)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVR KVAGEKITVTFNINN SIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCH YPEDEVGQEDEAESD IFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTF ADELVELSTALEHQE YITFLEDLKSFVKSQLEHHHHHH
    • Molecular weight
      31 kDa
    • Amino acids
      74 to 282
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Mature form.

Specifications

Our Abpromise guarantee covers the use of ab172818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.24% Tris, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • ASF/SF2 associated protein p32
    • C1q globular domain binding protein
    • C1qBP
    • C1QBP_HUMAN
    • Complement component 1 q subcomponent binding protein
    • Complement component 1 Q subcomponent binding protein mitochondrial
    • Complement component 1 Q subcomponent-binding protein, mitochondrial
    • GC1Q R
    • GC1q R protein
    • GC1q-R protein
    • GC1QBP
    • GC1QR
    • globular domain of, C1q, receptor for
    • Glycoprotein gC1qBP
    • HABP 1
    • HABP1
    • Hyaluronan binding protein 1
    • Hyaluronan-binding protein 1
    • Mitochondrial matrix protein p32
    • p32
    • p32 splicing factor
    • p33
    • Pre mrna splicing factor SF2 P32 subunit precursor
    • SF2p32
    • Splicing factor SF2 associated protein
    see all
  • Function
    Binds to the globular "heads" of C1Q thus inhibiting C1 activation.
  • Sequence similarities
    Belongs to the MAM33 family.
  • Cellular localization
    Mitochondrion matrix. Nucleus. Might also be nuclear in some cell types.
  • Information by UniProt

References

ab172818 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up