Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSALAQLRGILEGELEGIRGAGTWKSERVI TSRQGPHIRVDGVSGGILNFCANNYLGLSSHPEVIQAGLQALEEFGAGLS SVRFICGTQSIHKNLEAKIARFHQREDAILYPSCYDANAGLFEALLTPED AVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLQEAQKHRLRLVA TDGAFSMDGDIAPLQEICCLASRYGALVFMDECHATGFLGPTGRGTDELL GVMDQVTIINSTLGKALGGASGGYTTGPGPLVSLLRQRARPYLFSNSLPP AVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKMEAAGFTISGASHPICP VMLGDARLASRMADDMLKRGIFVIGFSYPVVPKGKARIRVQISAVHSEED IDRCVEAFVEVGRLHGALP
    • Molecular weight

      45 kDa including tags
    • Amino acids

      22 to 419
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 2 amino 3 ketobutyrate CoA ligase
    • 2 amino 3 ketobutyrate coenzyme A ligase, mitochondrial
    • 2-amino-3-ketobutyrate coenzyme A ligase
    • AKB ligase
    • Aminoacetone synthase
    • GCAT
    • Glycine acetyltransferase
    • glycine C acetyltransferase
    • glycine C acetyltransferase (2 amino 3 ketobutyrate coenzyme A ligase)
    • KBL_HUMAN
    • KLB
    • mitochondrial
    see all
  • Tissue specificity

    Strongly expressed in heart, brain, liver and pancreas. Also found in lung.
  • Pathway

    Amino-acid degradation; L-threonine degradation via oxydo-reductase pathway; glycine from L-threonine: step 2/2.
  • Sequence similarities

    Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156971 (3 µg).

References

ab156971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up