Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPND EVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYW DFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
    • Molecular weight

      42 kDa including tags
    • Amino acids

      1 to 146

Specifications

Our Abpromise guarantee covers the use of ab131819 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BRST-2
    • BRST2
    • GCDFP-15
    • GCDGP15
    • gp17
    • GPIP4
    • Gross cystic disease fluid protein 15
    • PIP
    • PIP_HUMAN
    • Prolactin induced protein
    • Prolactin inducible protein precursor
    • Prolactin-induced protein
    • Prolactin-inducible protein
    • SABP
    • Secretory actin binding protein
    • Secretory actin-binding protein
    see all
  • Tissue specificity

    Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.
  • Sequence similarities

    Belongs to the PIP family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131819 at approximately 41.8 kDa.

References

ab131819 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131819.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up