Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPL QGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAA VIPIKNNRFYTIEILKVE
    • Molecular weight

      18 kDa including tags
    • Amino acids

      29 to 146
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full-length mature chain lacking the signal peptide. N-terminal 6xHis-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • BRST-2
    • BRST2
    • GCDFP-15
    • GCDGP15
    • gp17
    • GPIP4
    • Gross cystic disease fluid protein 15
    • PIP
    • PIP_HUMAN
    • Prolactin induced protein
    • Prolactin inducible protein precursor
    • Prolactin-induced protein
    • Prolactin-inducible protein
    • SABP
    • Secretory actin binding protein
    • Secretory actin-binding protein
    see all
  • Tissue specificity

    Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.
  • Sequence similarities

    Belongs to the PIP family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab235867.

References

ab235867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up