Description

  • Product name

    Recombinant Human GCET2 protein
  • Purity

    > 85 % SDS-PAGE.
    ab137147 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMGNSLLRENRRQQNTQEMPWNVRMQSP KQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVD QTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETE YSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSH L
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 178
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab137147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • GCAT2
    • Gcet
    • GCET2 germinal center expressed transcript 2
    • GCET2 germinal centre expressed transcript 2
    • Gcsam
    • GCSAM_HUMAN
    • Germinal center associated lymphoma
    • Germinal center associated lymphoma protein
    • Germinal center B cell associated protein 2
    • Germinal center B-cell-expressed transcript 2 protein
    • Germinal center expressed transcript 2
    • Germinal center-associated lymphoma protein
    • Germinal center-associated signaling and motility protein
    • Germinal centre associated lymphoma
    • Germinal centre associated lymphoma protein
    • Germinal centre B cell associated protein 2
    • Germinal centre expressed transcript 2
    • hGAL
    • M17
    • M17 L
    see all
  • Function

    Involved in the negative regulation of lymphocyte motility. It mediates the migration-inhibitory effects of IL6. Serves as a positive regulator of the RhoA signaling pathway. Enhancement of RhoA activation results in inhibition of lymphocyte and lymphoma cell motility by activation of its downstream effector ROCK. Is a regulator of B-cell receptor signaling, that acts through SYK kinase activation.
  • Tissue specificity

    Expressed in diffuse large B-cell lymphoma (DLBCL) and several germinal center (GC)-like lymphoma cell lines (at protein level). Highly expressed in normal GC lymphocytes and GC-derived malignancies. Expressed in thymus and spleen.
  • Post-translational
    modifications

    Phosphorylation on tyrosine residues can be induced by IL6. Phosphorylation is mediated by LYN.
  • Cellular localization

    Cytoplasm. Cell membrane. It relocalizes from the cytoplasm to podosome-like structures upon cell treatment with IL6.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab137147.

References

ab137147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up