Description

  • Product name

    Recombinant Human GCHFR protein
  • Purity

    > 95 % SDS-PAGE.
    ab180307 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMPYLLISTQIRMEVGPTMVGDEQSDPE LMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTL VWCLHKE
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      1 to 84
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_005249

Specifications

Our Abpromise guarantee covers the use of ab180307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 40% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • GCHFR
    • GFRP
    • GFRP_HUMAN
    • GTP cyclohydrolase 1 feedback regulatory protein
    • GTP cyclohydrolase I feedback regulator
    • GTP cyclohydrolase I feedback regulatory protein
    • HsT16933
    • MGC138467
    • MGC138469
    • p35
    see all
  • Function

    Mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase 1. This inhibition is reversed by L-phenylalanine.
  • Tissue specificity

    In epidermis, expressed predominantly in basal undifferentiated keratinocytes and in some but not all melanocytes (at protein level).
  • Sequence similarities

    Belongs to the GFRP family.
  • Cellular localization

    Nucleus. Nucleus membrane. Cytoplasm > cytosol.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180307 (3 µg).

References

ab180307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up