Overview

  • Product name

    Recombinant Human GCNT1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEFVSVRHLELAG ENPSSDINCTKVLQGDVNEIQKVKLEILTVKFKKRPRWTPDDYINMTSDC SSFIKRRKYIVEPLSKEEAEFPIAYSIVVHHKIEMLDRLLRAIYMPQNFY CIHVDTKSEDSYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCM KDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETERMPSH KEERWKKRYEVVNGKLTNTGTVKMLPPLETPLFSGSAYFVVSREYVGYVL QNEKIQKLMEWAQDTYSPDEYLWATIQRIPEVPGSLPASHKYDLSDMQAV ARFVKWQYFEGDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFAN KFDVDVDLFAIQCLDEHLRHKALETLKH
    • Molecular weight

      73 kDa including tags
    • Amino acids

      1 to 428

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3-galactosyl-O-glycosyl-glycoprotein beta-1
    • 6-N-acetylglucosaminyltransferase
    • Beta-1
    • Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
    • C2GNT
    • C2GNT L
    • C2GNT1
    • C2GnTL
    • Core 2 branching enzyme
    • Core 2 GNT
    • Core 2-branching enzyme
    • Core2 GlcNAc transferase
    • Core2-GlcNAc-transferase
    • GCNT 1
    • GCNT1
    • GCNT1_HUMAN
    • glucosaminyl (N-acetyl) transferase 1 core 2
    • NACGT2
    see all
  • Function

    Forms critical branches in O-glycans.
  • Tissue specificity

    Highly expressed in activated T-lymphocytes and myeloid cells.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 14 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114895 at approximately 73.15kDa.
    Stained with Coomassie Blue.

References

ab114895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up