Overview

  • Product name
    Recombinant Human GCP-3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERD EFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSL SEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQS AQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLG SRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAAL VRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWL HNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLED DQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAV HAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVAS DPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSINFLHQVCHDQ TPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLN KKYSLLDHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGI LETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIAT VFTRECMSHYLRVFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGV LHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAA HEVFLDTIISRCLLDSDSRALLNQLRAVFDQIIELQNAQDAIYRAALEEL QRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESIPKMCSQLRIL THFYQGIVQQFLVLLTTSSDESLRFLSFRLDFNEHYKAREPRLRVSLGTR GRRSSHT
    • Amino acids
      1 to 907
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Gamma-tubulin complex component 3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gamma-ring complex protein 104 kDa
    • Gamma-tubulin complex component 3
    • GCP-3
    • GCP3
    • GCP3_HUMAN
    • h104p
    • hGCP3
    • hGrip104
    • hSpc98
    • SPBC98
    • Spc98p
    • Spindle pole body protein Spc98 homolog
    • TUBGCP3
    • Tubulin gamma complex associated protein 3
    see all
  • Function
    Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the GCP family.
  • Cellular localization
    Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Images

  • ab160986 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up