Description

  • Product name

    Recombinant Human GCPIII protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAESRGRLYLWMCLAAALASFLMGFMVGWFIKPLKETTTSVRYHQSIRWK LVSEMKAENIKSFLRSFTKLPHLAGTEQNFLLAKKIQTQWKKFGLDSAKL VHYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDGYENVTNIVPP YNAFSAQGMPEGDLVYVNYARTEDFFKLEREMGINCTGKIVIARYGKIFR GNKVKNAMLAGAIGIILYSDPADYFAPEVQPYPKGWNLPGTAAQRGNVLN LNGAGDPLTPGYPAKEYTFRLDVEEGVGIPRIPVHPIGYNDAEILLRYSF LVGYEIKIFCTSCLFSH
    • Amino acids

      1 to 317
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as NAALAD2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GCPIII
    • Glutamate carboxypeptidase III
    • N-acetylated-alpha-linked acidic dipeptidase 2
    • N-acetylated-alpha-linked acidic dipeptidase II
    • NAALAD2
    • NAALADase II
    • NALD2_HUMAN
    see all
  • Function

    Has N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Also exhibits a dipeptidyl-peptidase IV type activity. Inactivate the peptide neurotransmitter N-acetylaspartylglutamate.
  • Tissue specificity

    Highest expression in the testis. Also found in ovary and spleen. Weak expression in prostate, heart and placenta. In brain, expressed in striatum, parietal cortex and ventral striatum with lower levels in hippocampus, brain stem, putamen and superior colliculus.
  • Sequence similarities

    Belongs to the peptidase M28 family. M28B subfamily.
  • Domain

    The NAALADase activity is found in the central region, the dipeptidyl peptidase IV type activity in the C-terminal.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab160758 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up