Bioactive grade

Recombinant human GCSF Receptor protein (Active) (Biotin) (ab246045)

Description

  • Product name

    Recombinant human GCSF Receptor protein (Active) (Biotin)
    See all GCSF Receptor proteins and peptides
  • Biological activity

    Immobilized anti-human GCSF receptor at 2 μg/mL (100 μL/well) can bind ab246035 with a linear range of 0.2-6 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGR QQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPA IPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSI LDCVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDV VKLEPPMLRTMDPSPEAAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQR GEASWALVGPLPLEALQYELCGLLPATAYTLQIRCIRWPLPGHWSDWSPS LELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVPLEEDSGRIQGYVVS WRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPTPVVF SESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSN KTWRMEQNGRATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQE MAPSHAPELHLKHIGKTWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSF SAILNASSRGFVLHGLEPASLYHIHLMAASQAGATNSTVLTLMTLTP
    • Predicted molecular weight

      69 kDa including tags
    • Amino acids

      25 to 621
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      NP_000751. Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin. AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.4
    Constituents: PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • CD 114
    • CD114
    • CD114 antigen
    • Colony stimulating factor 3 receptor
    • Colony stimulating factor 3 receptor (granulocyte)
    • CSF 3R
    • CSF3R
    • CSF3R_HUMAN
    • Csfgr
    • G CSF R
    • G-CSF receptor
    • G-CSF-R
    • GCSFR
    • Granulocyte colony stimulating factor receptor
    • Granulocyte colony-stimulating factor receptor
    • OTTHUMP00000009703
    • OTTHUMP00000009704
    • OTTHUMP00000009705
    see all
  • Function

    Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface.
  • Tissue specificity

    One or several isoforms have been found in myelogenous leukemia cell line KG-1, leukemia U-937 cell line, in bone marrow cells, placenta, and peripheral blood granulocytes. Isoform GCSFR-2 is found only in leukemia U-937 cells. Isoform GCSFR-3 is highly expressed in placenta.
  • Involvement in disease

    Hereditary neutrophilia
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 5 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab246045 under reducing conditions. The gel was stained overnight with coomassie blue. The protein migrates to 72-85 kDa under reducing conditions due to glycosylation.

  • Immobilized anti-human GCSF receptor at 2 μg/mL (100 μL/well) can bind ab246045 with a linear range of 0.2-6 ng/mL.

References

ab246045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up