Description

  • Product name

    Recombinant human GDA protein (Active)
    See all GDA proteins and peptides
  • Biological activity

    Specific activity is > 2,000 pmol/min/µg, and is defined as the amount of enzyme that convert guanine to xanthine per minute at pH 8.0 at 37°C.

  • Purity

    > 90 % SDS-PAGE.
    ab222351 was purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQ QEKLAKEWCFKPCEIRELSHHEFFMPGLVDTHIHASQYSFAGSSIDLPLL EWLTKYTFPAEHRFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIHTDSS LLLADITDKFGQRAFVGKVCMDLNDTFPEYKETTEESIKETERFVSEMLQ KNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRDEVEA VKNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAH CPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVS NILLINKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILI NPKASDSPIDLFYGDFFGDISEAVIQKFLYLGDDRNIEEVYVGGKQVVPF SSSV
    • Predicted molecular weight

      51 kDa
    • Amino acids

      1 to 454
    • Additional sequence information

      NP_004284.

Specifications

Our Abpromise guarantee covers the use of ab222351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Functional Studies

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS, 0.02% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CYPIN
    • Cytoplasmic PSD95 interactor
    • D10S105E
    • GAH
    • GDA
    • GUAD_HUMAN
    • Guanase
    • Guanine aminase
    • Guanine aminohydrolase
    • Guanine deaminase
    • MGC9982
    • NEDASIN
    • p51-nedasin
    • SLC25A16
    see all
  • Function

    Catalyzes the hydrolytic deamination of guanine, producing xanthine and ammonia.
  • Pathway

    Purine metabolism; guanine degradation; xanthine from guanine: step 1/1.
  • Sequence similarities

    Belongs to the ATZ/TRZ family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222351.

References

ab222351 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222351.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up