Description

  • Product name

    Recombinant human GDF11 protein (Active)
    See all GDF11 proteins and peptides
  • Biological activity

    Alkaline phosphatase activity induced in ATDC-5 cells.

    Acceptance Criteria: ED50 ≤100 ng/mL(≥ 1.0 x 104 units/mg).

  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYM FMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPG MVVDRCGCS
    • Predicted molecular weight

      13 kDa
    • Amino acids

      299 to 407
    • Additional sequence information

      Source: genetically modified E.coli. Mature protein without the signal peptide and propeptide Exists as a dimer. Predicted MW: Dimer, 12.5/24.9 kDa (with 109/218 amino acids)

Specifications

Our Abpromise guarantee covers the use of ab218080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    This product shares 100% homology with amino acids 297-405 of Rat and Mouse GDF11.

     

     This product was previously labelled as BMP11, BMP11 + GDF8 / Myostatin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Sterile 10 mM HCl at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • BMP 11
    • BMP-11
    • BMP11
    • Bone morphogenetic protein 11
    • GDF 11
    • GDF-11
    • Gdf11
    • GDF11_HUMAN
    • Growth differentiation factor 11
    • Growth/differentiation factor 11
    see all
  • Function

    Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Functional analysis of ab218080
  • SDS-PAGE analysis of ab218080 at 1 μg under (1) non-reducing and (2) reducing conditions in a 4-20% Tris-Glycine gel, stained with Coomassie Blue. Human GDF11 is a homodimer with a total; predicted MW of 24.9 kDa (each monomer 12.4 kDa).

References

ab218080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up