Description

  • Product name

    Recombinant Human GDF7 protein
  • Biological activity

    Determined by its ability to inhibit induced alkaline phosphatase production by ATDC5 chondrogenic cells.
  • Purity

    > 98 % SDS-PAGE.
    ab115505 is greater than 98% by SDS-PAGE gel and HPLC analyses.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPL DYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLS PISILYIDAANNVVYKQYEDMVVEACGCR
    • Predicted molecular weight

      28 kDa
    • Amino acids

      322 to 450

Specifications

Our Abpromise guarantee covers the use of ab115505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Determined by its ability to inhibit induced alkaline phosphatase production by ATDC5 chondrogenic cells.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.

General Info

  • Alternative names

    • bmp12
    • bone morphogenetic protein 12
    • GDF-7
    • Gdf7
    • GDF7_HUMAN
    • growth differentiation factor 7
    • Growth/differentiation factor 7
    see all
  • Function

    May play an active role in the motor area of the primate neocortex.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab115505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up