Description

  • Product name

    Recombinant Human GDF8 / Myostatin protein
    See all GDF8 / Myostatin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Assessed by densitometry. Purifed using Ni-NTA chromatography.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HHHHHHASNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLR LETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATT ETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVET PTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNW LKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSR RDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEF VFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIP AMVVDRCGCS
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      24 to 375
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein and Propeptide without Signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab203723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    Western blot

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Additional notes

    Frozen from a 0.25–0.5 mg/ml solution. Defrost at ambient temperature. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 20% Glycerol, 80% PBS

General Info

  • Alternative names

    • GDF 8
    • GDF-8
    • GDF8
    • GDF8_HUMAN
    • Growth differentiation factor 8
    • Growth/differentiation factor 8
    • MSLHP
    • MSTN
    • Myostatin
    • OTTHUMP00000163498
    see all
  • Function

    Acts specifically as a negative regulator of skeletal muscle growth.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 14 % SDS-PAGE analysis of ab203723:
    1. Reduced and boiled sample, 2.5 μg/lane.
    2. Non-reduced and non-boiled sample, 2.5 μg/lane.

     

    The approx. 50 kDa band represents the complex of Myostatin-Propeptide. The band corresponding to approx. 38 kDa represents cleaved form of Propeptide and similarly the approx. 12 kDa band belongs to cleaved Myostatin domain. Myostatin domains makes dimmers in non-reducing conditions resulting in bends of approx. 25 and 97 kDa, respectively.

References

ab203723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up