Description

  • Product name

    Recombinant human GDNF protein (Animal Free)
    See all GDNF proteins and peptides
  • Biological activity

    The activity is determined by the dose-dependent proliferation of C6 cells and is typically 0.5-5 μg/ml.  This corresponds to an expected specific activity of 2 x 103 units/mg.

  • Purity

    = 97 % SDS-PAGE.
    The purity of ab218088 is determined by Reducing and Non-reducing SDS-PAGE.
  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLN VTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQ ACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
    • Predicted molecular weight

      30 kDa
    • Amino acids

      78 to 211
    • Additional sequence information

      This product is the mature full length protein from aa 78 to 211. The signal peptide and propeptide are not included. Non-glycosylated homodimer.

Specifications

Our Abpromise guarantee covers the use of ab218088 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 4.00
    Constituents: 0.29% Sodium citrate, 0.58% Sodium chloride

    Lyophilised from a sterile filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile water at 0.1 mg/ml. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 ºC and avoid repeat freeze thaws.

General Info

  • Alternative names

    • Astrocyte derived trophic factor
    • Astrocyte derived trophic factor 1
    • Astrocyte-derived trophic factor
    • Atf
    • ATF 1
    • ATF 2
    • ATF1
    • ATF2
    • gdnf
    • GDNF_HUMAN
    • Glial cell derived neurotrophic factor
    • Glial Cell Line Derived Neurotrophic Factor
    • Glial cell line-derived neurotrophic factor
    • Glial derived neurotrophic factor
    • HFB1 GDNF
    • hGDNF
    • HSCR3
    see all
  • Function

    Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.
  • Tissue specificity

    In the brain, predominantly expressed in the striatum with highest levels in the caudate and lowest in the putamen.
  • Involvement in disease

    Defects in GDNF may be a cause of Hirschsprung disease (HSCR) [MIM:142623]. In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction.
    Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS) [MIM:209880]; also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia.
  • Sequence similarities

    Belongs to the TGF-beta family. GDNF subfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Functional analysis of ab218088
  •  SDS PAGE analysis of ab218088 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.

References

ab218088 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218088.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up