Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNT MLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEE FYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLN DNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLF CSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADF HANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSP WCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPS FQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELS MCFTELTTNIIPGSNKVIKPNS
    • Molecular weight
      48 kDa including tags
    • Amino acids
      22 to 441
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Neurturin at 1 µg/ml can bind rh GDNF Receptor alpha 2 with an apparent KD < 8 nM.
  • Applications

    Functional Studies

    SDS-PAGE

    ELISA

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 97 % SDS-PAGE.
    ab167734 was lyophilized from 0.22 µm filtered solution.
  • Form
    Lyophilised
  • Additional notes
    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Neurturin at 1 µg/ml can bind rh GDNF Receptor alpha 2 with an apparent KD < 8 nM.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • GDNF family receptor alpha 2
    • GDNF family receptor alpha-2
    • GDNF receptor alpha-2
    • GDNF receptor beta
    • GDNFR beta
    • GDNFR-alpha-2
    • GDNFR-beta
    • GDNFRB
    • GFR alpha 2
    • GFR-alpha-2
    • GFRA 2
    • Gfra2
    • GFRA2_HUMAN
    • Glial cell line derived neurotrophic factor family receptor alpha2b
    • Glial cell line derived neurotrophic factor receptor beta
    • Neurturin receptor alpha
    • NRTNR alpha
    • NRTNR-alpha
    • NTNR alpha
    • NTNR-alpha
    • NTNRA
    • PI linked cell surface accessory protein
    • PI linked cell-surface accessory protein
    • RET ligand 2
    • RETL 2
    • RETL2
    • TGF beta related neurotrophic factor receptor 2
    • TGF-beta-related neurotrophic factor receptor 2
    • TRN receptor GPI anchored
    • TRNR 2
    • TRNR2
    see all
  • Function
    Receptor for neurturin. Mediates the NRTN-induced autophosphorylation and activation of the RET receptor. Also able to mediate GDNF signaling through the RET tyrosine kinase receptor.
    Isoform 2: Participates to NRTN-induced 'Ser-727' phosphorylation of STAT3.
  • Tissue specificity
    Isoform 1 is found in both brain and placenta.
  • Sequence similarities
    Belongs to the GDNFR family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab167734 and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 60-70 KDa due to glycosylation.

References

ab167734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up