Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFDVEHPEFLKAGKEPGLQIWRV EKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQD ESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVA SGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFILDLGNN IHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQV LGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQ GALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPK QTQVSVLPEGGETPLFKQFFKNWRDPDQTDGLGLSYLSSHIANVERVPFD AATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDS YIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQ SRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLFQVRANSA GATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLR VLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACS NKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEA LTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPL DRAMAELAA
    • Molecular weight

      84 kDa including tags
    • Amino acids

      3 to 731
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Full-length mature Human Gelsolin (731 aa, Isoform-2, derived from BC026033) gene was constructed with 29 aa N-terminal T7 / His / TEV cleavage site Tag. NP_937895.

Specifications

Our Abpromise guarantee covers the use of ab203536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab203536 was refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains; NaCl, KCl, EDTA, sucrose and DTT.

General Info

  • Alternative names

    • Actin depolymerizing factor
    • Actin-depolymerizing factor
    • ADF
    • AGEL
    • Brevin
    • DKFZp313L0718
    • GELS_HUMAN
    • Gelsolin
    • Gsn
    see all
  • Function

    Calcium-regulated, actin-modulating protein that binds to the plus (or barbed) ends of actin monomers or filaments, preventing monomer exchange (end-blocking or capping). It can promote the assembly of monomers into filaments (nucleation) as well as sever filaments already formed. Plays a role in ciliogenesis.
  • Tissue specificity

    Phagocytic cells, platelets, fibroblasts, nonmuscle cells, smooth and skeletal muscle cells.
  • Involvement in disease

    Defects in GSN are the cause of amyloidosis type 5 (AMYL5) [MIM:105120]; also known as familial amyloidosis Finnish type. AMYL5 is a hereditary generalized amyloidosis due to gelsolin amyloid deposition. It is typically characterized by cranial neuropathy and lattice corneal dystrophy. Most patients have modest involvement of internal organs, but severe systemic disease can develop in some individuals causing peripheral polyneuropathy, amyloid cardiomyopathy, and nephrotic syndrome leading to renal failure.
  • Sequence similarities

    Belongs to the villin/gelsolin family.
    Contains 6 gelsolin-like repeats.
  • Post-translational
    modifications

    Phosphorylation on Tyr-86, Tyr-409, Tyr-465, Tyr-603 and Tyr-651 in vitro is induced in presence of phospholipids.
  • Cellular localization

    Cytoplasm > cytoskeleton and Secreted.
  • Information by UniProt

References

ab203536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up