Recombinant Human Gemin 8 protein (ab162913)

Overview

  • Product name
    Recombinant Human Gemin 8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAVKASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCF NLPWYLPSALLPQSSYDNEAAYPQSFYDHHVAWQDYPCSSSHFRRSGQHP RYSSRIQASTKEDQALSKEEEMETESDAEVECDLSNMEITEELRQYFAET ERHREERRRQQQLDAERLDSYVNADHDLYCNTRRSVEAPTERPGERRQAE MKRLYGDSAAKIQAMEAAVQLSFDKHCDRKQPKYWPVIPLKF
    • Amino acids
      1 to 242
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FAM51A1
    • FLJ20514
    • FLJ43072
    • gem (nuclear organelle) associated protein 8
  • Relevance
    Gemin 8 forms a large macromolecular complex which includes other gemin proteins, SMN (survival motor neuron) protein and Unrip. This complex is required for assembly of small nuclear ribonucleoproteins (snRNPs) from Sm proteins and snRNAs. Gemin 8 mediates the binding of SMN with gemin 6 and gemin 7.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab162913 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up