Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLD PGDDISSLQQEITILRECRHPNVVAYIGSYLRNDRLWICMEFCGGGSLQE IYHATGPLEERQIAYVCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDV KLADFGVSGELTASVAKRRSFIGTPYWMAPEVAAVERKGGYNELCDVWAL GITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFL KLALTKNPKKRPTAEKLLQHPFTTQQLPRALLTQLLDKASDPHLGTPSPE DCELETYDMFPDTIHSRGQHGPAERTPSEIQFHQVKFGAPRRKETDPLNE PWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRSASEFQELDSPDDTMG TIKRAPFLGPLPTDPPAEEPLSSPPGTLPPPPSGPNSSPLLPTAWATMKQ REDPERSSCHGLPPTPKVHMGACFSKVFNGCPLRIHAAVTWIHPVTRDQF LVVGAEEGIYTLNLHELHEDTLEKLISHRCSWLYCVNNVLLSLSGKSTHI WAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPRRFALSTKIPDTKGCLQ CRVVRNPYTGATFLLAALPTSLLLLQWYEPLQKFLLLKNFSSPLPSPAGM LEPLVLDGKELPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEGI PGSAQQVIQVDRDTILVSFERCVRIVNMQGEPTATLAPELTFDFPIETVV CLQDSVLAFWSHGMQGRSLDTNEVTQEITDETRIFRVLGAHRDIILESIP TDNPEAHSNLYILTGHQSTY
    • Amino acids

      1 to 820
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Germinal Center Kinase

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • B lymphocyte serine/threonine protein kinase
    • B lymphocyte serine/threonine-protein kinase
    • BL44
    • GC kinase
    • GCK
    • Germinal center kinase
    • germinal centre kinase (GC kinase)
    • M4K2_HUMAN
    • Map4k2
    • MAPK/ERK kinase kinase kinase 2
    • MEK kinase kinase 2
    • MEKKK 2
    • Mitogen activated protein kinase kinase kinase kinase 2
    • Mitogen-activated protein kinase kinase kinase kinase 2
    • Rab8 interacting protein
    • Rab8 interacting protein, formerly
    • Rab8-interacting protein
    • RAB8IP
    • RAB8IP, formerly
    see all
  • Function

    Enhances MAP3K1 oligomerization, which may relieve amino-terminal mediated MAP3K1 autoinhibition and lead to activation following autophosphorylation. May play a role in the regulation of vesicle targeting or fusion.
  • Tissue specificity

    Highly expressed in germinal center but not mantle zone B-cells. Also expressed in lung, brain and placenta and at lower levels in other tissues examined.
  • Sequence similarities

    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 CNH domain.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cytoplasm. Basolateral cell membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab159296 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up