Description

  • Product name

    Recombinant Human GGCT protein
  • Purity

    > 95 % SDS-PAGE.
    ab103053 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMANSGCKDVTGPDEESFLYFAYGSNLLTER IHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIATIFQSPGDEVW GVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNY ESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDII KKGETQTL
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 188
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • C7orf24
    • CRF21
    • Cytochrome c-releasing factor 21
    • Gamma glutamyl cyclotransferase
    • Gamma-glutamylcyclotransferase
    • GCTG
    • GGC
    • Ggct
    • GGCT_HUMAN
    see all
  • Function

    Catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis. Induces release of cytochrome c from mitochondria with resultant induction of apoptosis.
  • Sequence similarities

    Belongs to the gamma-glutamylcyclotransferase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg of ab103053.

References

ab103053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up