Description

  • Product name

    Recombinant Human GGT5 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MARGYGATVSLVLLGLGLALAVIVLAVVLSRHQAPCGPQAFAHAAVAADS KVCSDIGRAILQQQGSPVDATIAALVCTSVVNPQSMGLGGGVIFTIYNVT TGKVEVINARETVPASHAPSLLDQCAQALPLGTGAQWIGVPGELRGYAEA HRRHGRLPWAQLFQPTIALLRGGHVVAPVLSRFLHNSILRPSLQASTLRQ LFFNGTEPLRPQDPLPWPALATTLETVATEGVEVFYTGRLGQMLVEDIAK EGSQLTLQDLAKFQPEVVDALEVPLGDYTLYSPPPPAGGAILSFILNVLR GFNFSTESMARPEGRVNVYHHLVETLKFAKGQRWRLGDPRSHPKLQNASR DLLGETLAQLIRQQIDGRGDHQLSHYSLAEAWGHGTGTSHVSVLGEDGSA VAATSTINTPFGAMVYSPRTGIILNNELLDLCERCPRGSGTTPSPAVSGD RVGGAPGRCWPPVPGERSPSSMVPSILINKAQGSKLVIGGAGGELIISAV AQAIMSKLWLGFDLRAAIAAPILHVNSKGCVEYEPNFSQEVQRGLQDRGQ NQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY
    • Amino acids

      1 to 587
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZP566O011
    • Gamma glutamyl transpeptidase related enzyme
    • Gamma glutamyltranspeptidase 5
    • Gamma-glutamyl transpeptidase-related enzyme
    • Gamma-glutamyltransferase 5 light chain
    • Gamma-glutamyltransferase-like activity 1
    • Gamma-glutamyltranspeptidase 5
    • GGT 5
    • GGT REL
    • GGT-rel
    • GGT5
    • GGT5_HUMAN
    • GGTLA1
    see all
  • Function

    Cleaves the gamma-glutamyl peptide bond of glutathione conjugates, but maybe not glutathione itself. Converts leukotriene C4 (LTC4) to leukotriene D4 (LTD4).
  • Pathway

    Sulfur metabolism; glutathione metabolism.
    Lipid metabolism; leukotriene D4 biosynthesis.
  • Sequence similarities

    Belongs to the gamma-glutamyltransferase family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab158516 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up