Overview

  • Product name
    Recombinant Human Giantin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQE RLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADN
    • Molecular weight
      36 kDa including tags
    • Amino acids
      3 to 91

Specifications

Our Abpromise guarantee covers the use of ab152432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 372 kDa Golgi complex associated protein
    • 372 kDa Golgi complex-associated protein
    • GCP
    • GCP372
    • Giantin
    • GOGB1_HUMAN
    • GOLGB1
    • Golgi autoantigen golgin subfamily a member 1
    • Golgi autoantigen golgin subfamily b macrogolgin (with transmembrane signal) 1
    • Golgi autoantigen, golgin subfamily b, macrogolgin 1
    • Golgi complex associated protein 372kDa
    • Golgi complex-associated protein 372kDa
    • Golgin B1
    • Golgin B1, golgi integral membrane protein
    • Golgin subfamily B member 1
    • GOLIM1
    • Macrogolgin
    • MGC33154
    see all
  • Function
    May participate in forming intercisternal cross-bridges of the Golgi complex.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152432 stained with Coomassie Blue.

References

ab152432 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Filter by Application

Filter by Ratings

Application
Immunoprecipitation
To detect the complexes between N-terminal of giantin and other Golgi proteins, we employed the recombinant human N-terminal GST-giantin fusion peptide (3-92 aa). This peptide is successfully immobilized by anti-GST Ab ab19256 coupled Epoxy beads (Dynabeads M-450), according to the GST Western blot (W-B) - see picture.

Abcam user community

Verified customer

Submitted Nov 19 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up