For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-gilt-protein-ab134622.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Adaptive Immunity MHC Class II
Share by email

Recombinant Human GILT protein (ab134622)

  • Datasheet
Submit a review Q&A (4)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human GILT protein (ab134622)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 85% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: MS, SDS-PAGE

    Description

    • Product name

      Recombinant Human GILT protein
      See all GILT proteins and peptides
    • Purity

      > 85 % SDS-PAGE.
      ab134622 is purified by conventional column chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
    • Expression system

      Escherichia coli
    • Accession

      P13284
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MGSSHHHHHHSSGLVPRGSHMGSMNAPLVNVTLYYEALCGGCRAFLIREL FPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACV LDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDR GMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK
      • Predicted molecular weight

        23 kDa including tags
      • Amino acids

        58 to 232
      • Tags

        His tag N-Terminus

    Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab134622 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Mass Spectrometry

      SDS-PAGE

    • Mass spectrometry

      MALDI-TOF
    • Form

      Liquid
    • Additional notes

       This product was previously labelled as IFI30

       

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 8.00
      Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride

    General Info

    • Alternative names

      • Gamma interferon inducible lysosomal thiol reductase
      • Gamma interferon inducible protein IP 30
      • Gamma-interferon-inducible lysosomal thiol reductase
      • Gamma-interferon-inducible protein IP-30
      • GILT
      • GILT_HUMAN
      • IFI 30
      • IFI30
      • interferon gamma inducible protein 30
      • Interferon gamma inducible protein 30 preproprotein
      • IP30
      • Legumaturain
      • Lysosomal thiol reductase
      • Lysosomal thiol reductase, gamma-interferon-inducible
      see all
    • Function

      Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds (By similarity). Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation.
    • Sequence similarities

      Belongs to the GILT family.
    • Post-translational
      modifications

      N-glycosylated. Sugar chains contain mannose-6-phosphate.
      Synthesized as a 35 kDa precursor which is then processed into the mature 30 kDa form via cleavage of N-terminal and C-terminal propeptides. Processing of the precursor is mediated by multiple lysosomal proteases.
    • Cellular localization

      Secreted. Lysosome.
    • Target information above from: UniProt accession P13284 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human GILT protein (ab134622)
      SDS-PAGE - Recombinant Human GILT protein (ab134622)

      15% SDS-PAGE analysis of 3 µg ab134622.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab134622? Please let us know so that we can cite the reference in this datasheet.

    ab134622 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-4 of 4 Abreviews or Q&A

    Question

    I realise that, but if the experiment doesn’t work, then what will be getting my money back on?
    I won’t be buying any more IFI30 if it isn’t active, so I will still be £350 down even if I try to find something else to buy, which I likely won’t need.

    I will happily buy the protein for £350. I’d even happily buy a smaller sample (e.g. £70 for 10 mg), I just don’t want to commit nearly 10% of my annual consumables budget to a protein which may be useless to me.

    Read More

    Abcam community

    Verified customer

    Asked on Sep 24 2012

    Answer

    We would really like to help you with this protein so we are happy to give you XX% discount. The terms and conditions would be like this

    - Purchase the protein at full price
    - Test the bio-activity of protein
    - Submit the Abreview
    - Get a XX refund of your money

    I hope you would find this offer interesting.

    Thank you very much for your cooperation in this case.

    Read More

    Abcam Scientific Support

    Answered on Sep 24 2012

    Question

    I will consider this, however, if the enzyme has no function, I’ll have spent £350 for something I cannot use.

    If this ends up the case, I will have nothing to get my 100% discount on as I will not be buying more of a product I do not need.

    Surely if you consult with your management, you can find a solution which will benefit both AbCam and myself. Whichever protein we use will feature in the research paper we are writing.

    Read More

    Abcam community

    Verified customer

    Asked on Sep 24 2012

    Answer

    I am sorry for the confusion, let me explain it again.

    The 100% discount codewill still be valid if you get your results or not. If the experiments ends with non functioning enzyme then you can still submit an Abreview and you will be able to spend the discount code money£355 on other products of your choice. Ultimately you are getting your money back.

    Let me know if you are interested inthis code...

    Read More

    Abcam Scientific Support

    Answered on Sep 24 2012

    Question

    Thanks you for the quick response. If you send me a 2 µg sample, I would be happy to test its activity so I can determine if I can use it for my experiments.

    This has the benefit of saving me the time of waiting for your activity tests and also benefits AbCam by allowing me to purchase sooner. If you like, I can also share the data with you.

    The work I am doing is also being used for a research paper, so this would benefit AbCam by giving you a reference for the product page.

    Please let me know if you would like to go ahead with this. AbNova have sent us a 2 µg sample of their IFI30, but theirs is not the mature protein and is GST rather than His tagged, and our study involves GST, so we’d really prefer the AbCam one.

    Read More

    Abcam community

    Verified customer

    Asked on Sep 21 2012

    Answer

    Thank for your email.

    Regrettably, we do not provide free of charge samples. however I can provide you100% Abreview testing discount. To avail the discount you need to buy this product at full price, test its activity, submit an Abreview using online system and get your next product protein or antibody of similar prize totally free of charge.

    It does not matter you get positive or negative results your discount code will be valid once you submit Abreview. So it is a similar offer but in different way.

    The terms and conditions can be found at the following link;

    https://www.abcam.com/index.html?pageconfig=resource&rid=11998&viapagetrap=collaborationdiscount

    Please contact for the discount code.

    Read More

    Abcam Scientific Support

    Answered on Sep 21 2012

    Question

    Product code: 134622
    Inquiry: Does this protein have its native activity? If you do not have any data for this, would it be possible to obtain a sample in order to assay for activity which would enable me to order and I could provide you with any data I acquire showing activity.

    Read More

    Abcam community

    Verified customer

    Asked on Sep 21 2012

    Answer

    Thank you for contacting us.

    Lab has confirmed that our protein’s biological activity hasn’t been tested yet, and we can’t give you a specific date on when we will test it. I should mention that it hasn’t been exposed to denaturing agents, so it is possible that it’s bioactive.

    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Use our products? Submit an Abreview. Earn rewards!
    https://www.abcam.com/abreviews

    Read More

    Abcam Scientific Support

    Answered on Sep 21 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.