Recombinant Human GILT protein (ab134622)

Submit a review Q&A (4)
SDS-PAGE - Recombinant Human GILT protein (ab134622)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 85% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: MS, SDS-PAGE

    Description

    • Product name

      Recombinant Human GILT protein
      See all GILT proteins and peptides

    • Purity

      > 85 % SDS-PAGE.
      ab134622 is purified by conventional column chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.

    • Expression system

      Escherichia coli

    • Accession

      P13284

    • Protein length

      Full length protein

    • Animal free

      No

    • Nature

      Recombinant

      • Species

        Human

      • Sequence

        MGSSHHHHHHSSGLVPRGSHMGSMNAPLVNVTLYYEALCGGCRAFLIREL FPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACV LDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDR GMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK

      • Predicted molecular weight

        23 kDa including tags

      • Amino acids

        58 to 232

      • Tags

        His tag N-Terminus

    Specifications

    Our Abpromise guarantee covers the use of ab134622 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Mass Spectrometry

      SDS-PAGE

    • Mass spectrometry

      MALDI-TOF

    • Form

      Liquid

    • Additional notes

       This product was previously labelled as IFI30

       

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 8.00
      Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol (glycerin, glycerine), 0.58% Sodium chloride

    General Info

    • Alternative names

      • Gamma interferon inducible lysosomal thiol reductase
      • Gamma interferon inducible protein IP 30
      • Gamma-interferon-inducible lysosomal thiol reductase
      • Gamma-interferon-inducible protein IP-30
      • GILT
      • GILT_HUMAN
      • IFI 30
      • IFI30
      • interferon gamma inducible protein 30
      • Interferon gamma inducible protein 30 preproprotein
      • IP30
      • Legumaturain
      • Lysosomal thiol reductase
      • Lysosomal thiol reductase, gamma-interferon-inducible
      see all

    • Function

      Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds (By similarity). Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation.

    • Sequence similarities

      Belongs to the GILT family.

    • Post-translational
      modifications

      N-glycosylated. Sugar chains contain mannose-6-phosphate.
      Synthesized as a 35 kDa precursor which is then processed into the mature 30 kDa form via cleavage of N-terminal and C-terminal propeptides. Processing of the precursor is mediated by multiple lysosomal proteases.

    • Cellular localization

      Secreted. Lysosome.
    • Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human GILT protein (ab134622)
      SDS-PAGE - Recombinant Human GILT protein (ab134622)

      15% SDS-PAGE analysis of 3 µg ab134622.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab134622? Please let us know so that we can cite the reference in this datasheet.

    ab134622 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-4 of 4 Abreviews or Q&A

    Question

    I realise that, but if the experiment doesn’t work, then what will be getting my money back on?
    I won’t be buying any more IFI30 if it isn’t active, so I will still be £350 down even if I try to find something else to buy, which I likely won’t need.

    I will happily buy the protein for £350. I’d even happily buy a smaller sample (e.g. £70 for 10 mg), I just don’t want to commit nearly 10% of my annual consumables budget to a protein which may be useless to me.

    Read More
    Answer

    We would really like to help you with this protein so we are happy to give you XX% discount. The terms and conditions would be like this

    - Purchase the protein at full price
    - Test the bio-activity of protein
    - Submit the Abreview
    - Get a XX refund of your money

    I hope you would find this offer interesting.

    Thank you very much for your cooperation in this case.

    Read More

    Question

    I will consider this, however, if the enzyme has no function, I’ll have spent £350 for something I cannot use.

    If this ends up the case, I will have nothing to get my 100% discount on as I will not be buying more of a product I do not need.

    Surely if you consult with your management, you can find a solution which will benefit both AbCam and myself. Whichever protein we use will feature in the research paper we are writing.

    Read More
    Answer

    I am sorry for the confusion, let me explain it again.

    The 100% discount codewill still be valid if you get your results or not. If the experiments ends with non functioning enzyme then you can still submit an Abreview and you will be able to spend the discount code money£355 on other products of your choice. Ultimately you are getting your money back.

    Let me know if you are interested inthis code...

    Read More

    Question

    Thanks you for the quick response. If you send me a 2 µg sample, I would be happy to test its activity so I can determine if I can use it for my experiments.

    This has the benefit of saving me the time of waiting for your activity tests and also benefits AbCam by allowing me to purchase sooner. If you like, I can also share the data with you.

    The work I am doing is also being used for a research paper, so this would benefit AbCam by giving you a reference for the product page.

    Please let me know if you would like to go ahead with this. AbNova have sent us a 2 µg sample of their IFI30, but theirs is not the mature protein and is GST rather than His tagged, and our study involves GST, so we’d really prefer the AbCam one.

    Read More
    Answer

    Thank for your email.

    Regrettably, we do not provide free of charge samples. however I can provide you100% Abreview testing discount. To avail the discount you need to buy this product at full price, test its activity, submit an Abreview using online system and get your next product protein or antibody of similar prize totally free of charge.

    It does not matter you get positive or negative results your discount code will be valid once you submit Abreview. So it is a similar offer but in different way.

    The terms and conditions can be found at the following link;

    https://www.abcam.com/index.html?pageconfig=resource&rid=11998&viapagetrap=collaborationdiscount

    Please contact for the discount code.

    Read More

    Question

    Product code: 134622
    Inquiry: Does this protein have its native activity? If you do not have any data for this, would it be possible to obtain a sample in order to assay for activity which would enable me to order and I could provide you with any data I acquire showing activity.

    Read More
    Answer

    Thank you for contacting us.

    Lab has confirmed that our protein’s biological activity hasn’t been tested yet, and we can’t give you a specific date on when we will test it. I should mention that it hasn’t been exposed to denaturing agents, so it is possible that it’s bioactive.

    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Use our products? Submit an Abreview. Earn rewards!
    https://www.abcam.com/abreviews

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com