Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTG SGKSATGNSILGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNIL SPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVF GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFN NRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQE RQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL
    • Amino acids
      1 to 292
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GIMA6_HUMAN
    • Gimap6
    • GTPase IMAP family member 6
    • hIAN2
    • hIAN6
    • Human immune associated nucleotide 2
    • IAN-2
    • IAN-6
    • IAN6
    • Immune associated nucleotide 2
    • Immune associated nucleotide 6
    • Immunity associated nucleotide 6 protein
    • Immunity-associated nucleotide 2 protein
    • Immunity-associated nucleotide 6 protein
    see all
  • Tissue specificity
    Highly expressed in spleen, lymph nodes, lung and placenta. Expressed at moderate level in thymus, kidney, heart and digestive tract. Weakly expressed in other lymphoid tissues.
  • Sequence similarities
    Belongs to the IAN GTP-binding protein family.
  • Information by UniProt

Images

  • ab166556 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166556 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up