Description

  • Product name

    Recombinant Human GINS2 protein
  • Purity

    > 90 % SDS-PAGE.
    ab182799 is expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGEFGSMDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDL GPFNPGLPVEVPLWLAINLKQRQKCRLLPPEWMDVEKLEKMRDHERKEET FTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSAD SFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQ DF
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 185
    • Tags

      T7 tag N-Terminus
    • Additional sequence information

      Mature protein; 17 aa N-terminal T7 tag. NP_057179.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab182799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as PSF2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituent: 0.32% Tris HCl

    Buffer also contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • DNA replication complex GINS protein PSF2
    • GINS complex subunit 2
    • GINS complex subunit 2 (Psf2 homolog)
    • gins2
    • HSPC037
    • Pfs2
    • PSF2
    • PSF2_HUMAN
    see all
  • Function

    The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.
  • Sequence similarities

    Belongs to the GINS2/PSF2 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab182799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up