Overview

  • Product name

    Recombinant Human GIP protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Cell Culture
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      RVPHVQGEQQEWEGTEELPSPPDHAERAEEQHEKYRPSQDQGLPASRCLR CCDPGTSMYP ATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGSMG APGERCKSHY AAFSVGRKKPMHSNHYYQTVIFDTEFVNLYDHFNMFTGKFYCYVPGLYFF SLNVHTWNQK ETYLHIMKNEEEVVILFAQVGDRSIMQSQSLMLELREQDQVWVRLYKGER ENAIFSEELD TYITFSGYLVKHATEP
    • Molecular weight

      29 kDa
    • Amino acids

      26 to 281
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as CTRP1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at room temperature. Store at -20°C.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles

General Info

  • Alternative names

    • C1q and tumor necrosis factor related protein 1
    • C1QT1_HUMAN
    • C1QTNF1
    • Complement C1q tumor necrosis factor related protein 1
    • Complement C1q tumor necrosis factor-related protein 1
    • CTRP 1
    • CTRP1
    • FLJ90694
    • G protein coupled receptor interacting protein 1
    • G protein-coupled receptor-interacting protein
    • GIP
    • ZSIG37
    see all
  • Sequence similarities

    Contains 1 C1q domain.
    Contains 1 collagen-like domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151376.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up