Overview

  • Product name

    Recombinant Human GIRK2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTK RKIQRYVRKDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVY TVTWLFFGMIWWLIAYIRGDMDHIEDPSWTPCVTNLNGFVSAFLFSIETE TTIGYGYRVITDKCPEGIILLLIQSVLGSIVNAFMVGCMFVKISQPKKRA ETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEG EFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVD YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEE EKNLEEQTERNGDVANLENESKV
    • Molecular weight

      75 kDa including tags
    • Amino acids

      1 to 423

Specifications

Our Abpromise guarantee covers the use of ab132375 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BIR1
    • G protein activated inward rectifier potassium channel 2
    • G protein-activated inward rectifier potassium channel 2
    • GIRK-2
    • GIRK2
    • hiGIRK2
    • Inward rectifier K(+) channel Kir3.2
    • Inward rectifier potassium channel KIR3.2
    • inwardly rectifying subfamily J member 6
    • KATP-2
    • KATP2
    • KCNJ6
    • KCNJ6_HUMAN
    • Kcnj7
    • KIR3.2
    • KPLBS
    • Potassium channel
    • Potassium channel inwardly rectifying subfamily J member 6
    • Potassium inwardly rectifying channel subfamily J member 6
    • Potassium voltage gated channel subfamily J member 6
    see all
  • Function

    This potassium channel may be involved in the regulation of insulin secretion by glucose and/or neurotransmitters acting through G-protein-coupled receptors. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.
  • Tissue specificity

    Most abundant in cerebellum, and to a lesser degree in islets and exocrine pancreas.
  • Involvement in disease

    Keppen-Lubinsky syndrome
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ6 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132375 stained with Coomassie Blue.

References

ab132375 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132375.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up