Description

  • Product name

    Recombinant Human GITR protein
    See all GITR proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab208317 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCV QPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHE GHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLEHHHHHH
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      26 to 162
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_004186.

Specifications

Our Abpromise guarantee covers the use of ab208317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as TNFRSF18

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • Activation inducible TNFR family receptor
    • Activation-inducible TNFR family receptor
    • AITR
    • CD357
    • GITR
    • GITR D
    • GITR-D
    • GITRD
    • Glucocorticoid induced TNFR related protein
    • glucocorticoid-induced tnf receptor ligand
    • glucocorticoid-induced tnf receptors ligand
    • Glucocorticoid-induced TNFR-related protein
    • TNF receptor superfamily activation inducible protein
    • TNFRSF 18
    • TNFRSF18
    • TNR18_HUMAN
    • Tumor necrosis factor receptor superfamily member 18
    • Tumor necrosis factor receptor superfamily member 18 precursor
    see all
  • Function

    Receptor for TNFSF18. Seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. Mediated NF-kappa-B activation via the TRAF2/NIK pathway.
  • Tissue specificity

    Expressed in lymph node, peripheral blood leukocytes and weakly in spleen.
  • Sequence similarities

    Contains 3 TNFR-Cys repeats.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab208317 (3µg).

    Observed MW: 18-28KDa (SDS–PAGE under reducing conditions).

References

ab208317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up