Description

  • Product name

    Recombinant Human GJA10 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLRVAAEDVWDDEQS AFACNTRQPGCNNICYDDAFPISLIRFWVLQIIFVSSPSLVYMGHALYRL RAFEKDRQRKKSHLRAQMENPDLDLEEQQRIDRELRRLEEQKRIHKVPLK GCLLRTYVLHILTRSVLEVGFMIGQYILYGFQMHPLYKCTQPPCPNAVDC FVSRPTEKTIFMLFMHSIAAISLLLNILEIFHLGIRKIMRTLYKKSSSEG IEDETGPPFHLKKYSVAQQCMICSSLPERISPLQANNQQQVIRVNVPKSK TMWQIPQPRQLEVDPSNGKKDWSEKDQHSGQLHVHSPCPWAGSAGNQHLG QQSDHSSFGLQNTMSQSWLGTTTAPRNCPSFAVGTWEQSQDPEPSGEPLT DLHSHCRDSEGSMRESGVWIDRSRPGSRKASFLSRLLSEKRHLHSDSGSS GSRNSSCLDFPHWENSPSPLPSVTGHRTSMVRQAALPIMELSQELFHSGC FLFPFFLPGVCMYVCVDREADGGGDYLWRDKIIHSIHSVKFNS
    • Amino acids

      1 to 543
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Gap junction alpha 10
    • Connexin 58
    • Connexin 59
    • Connexin-62
    • CX58
    • CX59
    • Cx62
    • CXA10_HUMAN
    • Gap junction alpha 10 protein
    • Gap junction alpha 9 protein
    • Gap junction alpha-10 protein
    • Gap junction protein alpha 10 59kDa
    • Gap junction protein alpha 9 59kDa
    • GJA10
    • MGC50985
    see all
  • Function

    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Involved in tracer coupling between horizontal cells of the retina. May play a role in the regulation of horizontal cell patterning.
  • Tissue specificity

    Expressed in skeletal muscle and heart.
  • Sequence similarities

    Belongs to the connexin family. Alpha-type (group II) subfamily.
  • Cellular localization

    Cell membrane. Cell junction > gap junction.
  • Information by UniProt

Images

  • ab164639 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up