Overview

  • Product name

    Recombinant Human GJB3/CX31 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MDWKTLQALLSGVNKYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKD FDCNTKQPGCTNVCYDNYFPISNIRLWALQLIFVTCPSLLVILHVAYREE RERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLH TLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIV LTICELCYLICHRVLRGLHKDKPRGGCSPSSSASRASTCRCHHKLVEAGE VDPDPGNNKLQASAPNLTPI
    • Amino acids

      1 to 270
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as GJB3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Connexin 31
    • Connexin-31
    • Connexin31
    • CX 31
    • Cx31
    • CXB3_HUMAN
    • DFNA 2
    • DFNA2
    • DFNA2B
    • EKV
    • FLJ22486
    • Gap junction beta 3 protein
    • Gap junction beta-3 protein
    • Gap junction protein beta 3
    • Gap junction protein beta 3 31kDa
    • GJB 3
    • Gjb3
    • MGC102938
    see all
  • Function

    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Involvement in disease

    Defects in GJB3 are a cause of erythrokeratodermia variabilis (EKV) [MIM:133200]. EKV is a genodermatosis characterized by the appearance of two independent skin lesions: transient figurate erythematous patches and hyperkeratosis that is usually localized but occasionally occurs in its generalized form. Clinical presentation varies significantly within a family and from one family to another. Palmoplantar keratoderma is present in around 50% of cases.
    Defects in GJB3 are the cause of deafness autosomal dominant type 2B (DFNA2B) [MIM:612644]. DFNA2 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities

    Belongs to the connexin family. Beta-type (group I) subfamily.
  • Cellular localization

    Cell membrane. Cell junction > gap junction.
  • Information by UniProt

Images

  • ab158524 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up