Description

  • Product name

    Recombinant Human GK2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKE GWVEQDPKEILQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIW DKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFS AVKLRWMLDNVRNVQKAVEEGRALFGTIDSWLIWSLTGGVNGGVHCTDVT NASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIYGLIKTGALEG VPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGL LTTVAYKLGREKPAYYALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAK EVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAV CFQTREILEAMNRDCGIPLRHLQVDGGMTNNKVLMQLQADILHIPVIKPF MPETTALGAAMAAGAAEGVSVWSLEPQALSVLRMERFEPQIQATESEIRY ATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSSMVMLIGARYIS GVP
    • Amino acids

      1 to 553
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158527 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP:glycerol 3 phosphotransferase
    • EC 2.7.1.30
    • GK
    • GK 2
    • GKP2
    • GKTA
    • Glycerokinase
    • Glycerol kinase 2
    • Glycerol kinase testis specific 2
    see all
  • Relevance

    GK2 (glycerol kinase 2) is a key enzyme in the regulation of glycerol uptake and metabolism. It is a phosphotransferase enzyme involved in lipolysis and catalyzes the transfer of a phosphate from ATP to glycerol thus forming glycerol phosphate. This protein could be the product of a pseudogene.
  • Cellular localization

    Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side (By similarity). Cytoplasm (By similarity). In sperm the majority of the enzyme is bound to mitochondria.

Images

  • ab158527 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158527 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158527.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up