Recombinant Human GlcAT-I protein (ab156962)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSQPCDCLPPLRAAAEQLRQKDLRISQLQ AELRRPPPAPAQPPEPEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPR LHWLLVEDAEGPTPLVSGLLAASGLLFTHLVVLTPKAQRLREGEPGWVHP RGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFE EMRWTRGVSV WPVGLVGGLR FEGPQVQDGRVVGFHTAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTA PRGHLESSLLSHLVDPKDLEPRAANCTRVLVWHTRTEKPKMKQEEQLQRQ GRGSDPAIEV
    • Molecular weight
      36 kDa including tags
    • Amino acids
      29 to 335
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156962 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Additional notes

    Previously labelled as B3GAT3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • 3-Gal-R glucuronyltransferase
    • 3-glucuronyltransferase 3
    • B3GA3_HUMAN
    • B3GAT3
    • Beta 1,3 glucuronyltransferase 3
    • Beta 1,3 glucuronyltransferase 3 (glucuronosyltransferase I)
    • Beta-1
    • EC 2.4.1.135
    • Galactosylgalactosylxylosylprotein 3 beta glucuronosyltransferase 3
    • Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
    • GlcAT-I
    • GLCATI
    • glcUAT I
    • GlcUAT-I
    • GlcUATI
    • Glucuronosyltransferase I
    • Sqv 8 like protein
    • UDP GlcUA:Gal beta 1,3 Gal R glucuronyltransferase
    • UDP GlcUA:Gal beta 1,3 GalR glucuronyltransferase
    • UDP-GlcUA:Gal beta-1
    see all
  • Function
    Glycosaminoglycans biosynthesis. Involved in forming the linkage tetrasaccharide present in heparan sulfate and chondroitin sulfate. Transfers a glucuronic acid moiety from the uridine diphosphate-glucuronic acid (UDP-GlcUA) to the common linkage region trisaccharide Gal-beta-1,3-Gal-beta-1,4-Xyl covalently bound to a Ser residue at the glycosaminylglycan attachment site of proteoglycans. Can also play a role in the biosynthesis of l2/HNK-1 carbohydrate epitope on glycoproteins. Shows strict specificity for Gal-beta-1,3-Gal-beta-1,4-Xyl, exhibiting negligible incorporation into other galactoside substrates including Galbeta1-3Gal beta1-O-benzyl, Galbeta1-4GlcNAc and Galbeta1-4Glc.
  • Tissue specificity
    Ubiquitous (but weakly expressed in all tissues examined).
  • Pathway
    Protein modification; protein glycosylation.
  • Involvement in disease
    Defects in B3GAT3 are the cause of multiple joint dislocations short stature craniofacial dysmorphism and congenital heart defects (JDSSDHD) [MIM:245600]. An autosomal recessive disease characterized by dysmorphic facies, bilateral dislocations of the elbows, hips, and knees, clubfeet, and short stature, as well as cardiovascular defects.
  • Sequence similarities
    Belongs to the glycosyltransferase 43 family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Golgi apparatus membrane. Golgi apparatus > cis-Golgi network.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156962 (3 µg).

References

ab156962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up