Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      GPLPRAPSISTVEPKREREGGPIREESRLTVPEGAMKPQPSPGAQSSCSS DHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGTGLSTLRRLEN
    • Molecular weight

      37 kDa including tags
    • Amino acids

      401 to 500

Specifications

Our Abpromise guarantee covers the use of ab152427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GLI
    • Gli 1
    • GLI family zinc finger 1
    • GLI Kruppel family member 1
    • gli1
    • GLI1_HUMAN
    • Glioma associated oncogene 1
    • Glioma associated oncogene homolog
    • Glioma associated oncogene homolog 1 (zinc finger protein)
    • Glioma-associated oncogene
    • Oncogene GLI
    • Zfp 5
    • Zfp5
    • Zinc finger protein GLI 1
    • Zinc finger protein GLI1
    see all
  • Function

    Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation.
  • Tissue specificity

    Testis, myometrium and fallopian tube. Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract.
  • Sequence similarities

    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Phosphorylated in vitro by ULK3.
  • Cellular localization

    Cytoplasm. Nucleus. Tethered in the cytoplasm by binding to SUFU. Activation and translocation to the nucleus is promoted by interaction with STK36. Phosphorylation by ULK3 may promote nuclear localization. Translocation to the nucleus is promoted by interaction with ZIC1.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152427 stained with Coomassie Blue.

References

ab152427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up