Overview

  • Product name

    Recombinant human GLIS1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AEARTSLSAHCRGPLATGLHPDLDLPGRSLATPAPSCYLLGSEPSSGLGL QPETHLPEGSLKRCCVLGLPPTSPASSSPCASSDVTSIIRSSQTSLVTCV NGLRSPPLTGDLGGPSKRARPGPASTDSHEGSLQLEACRKASFLKQEPAD EFSELFGPHQQGLPPPYPLSQLPPGPSLGGLGLGLAGRVVAGRQACRWVD CCAAYEQQEELVRHIEKSHIDQRKGEDFTCFWAGCVRRYKPFNARYKLLI HMRVHSGEKPNKCMFEGCSKAFSRLENLKIHLRSHTGEKPYLCQHPGCQK AFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKEQ QVRKKLHAGPDTEADVLTECLVLQQLHTSTQLAASDGKGGCGLGQELLPG VYPGSITPHNGLASGLLPPAHDVPSRHHPLDATTSSHHHLSPLPMAESTR DGLGPGLLSPIVSPLKGLGPPPLPPSSQSHSPGGQPFPTLPSKPSYPPFQ SPPPPPLPSPQGYQGSFHSIQSCFPYGDCYRMAEPAAGGDGLVGETHGFN PLRPNGYHSLSTPLPATGYEALAEASCPTALPQQPSEDVVSSGPEDCGFF PNGAFDHCLGHIPSIYTDTLEESGGGGSPGRRRRRRRRRRR
    • Molecular weight

      69 kDa including tags
    • Amino acids

      2 to 620

Specifications

Our Abpromise guarantee covers the use of ab134895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Protein transduction for in vitro somatic cell reprogramming study.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134895 was expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology, chromatographically purified and sterile-filtered.
  • Form

    Liquid
  • Additional notes

    Protein transduction for in vitro somatic cell reprogramming study.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.05% DTT, 0.32% Tris HCl, 0.02% EDTA, 3.4% DL-Arginine

    Buffer contains: Sodium chloride, Potassium chloride and Glycerol.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • FLJ36155|
    • GLI similar 1
    • GLI-similar 1
    • Gli5 like
    • GLIS 1
    • GLIS family zinc finger 1
    • Glis1
    • Glis1 like
    • GLIS1_HUMAN
    • Zinc finger protein GLIS1
    see all
  • Function

    Acts as both a repressor and activator of transcription. Binds to the consensus sequence 5'-GACCACCCAC-3'.
  • Sequence similarities

    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab134895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up